Translocation des protéines

Click here to load reader

  • date post

    05-Jan-2017
  • Category

    Documents

  • view

    221
  • download

    1

Embed Size (px)

Transcript of Translocation des protéines

  • PHYSIQUE CELLULAIRE- 4 -

    TRANSLOCATION DES PROTINES

    Jean-Pierre HENRY21 Mars 2008

  • Hypothse de travail:

    Au niveau : reticulum endoplasmique,mitochondries, bactries, chloroplastes

    la translocation est linaire La spcificit est donne par une

    prsquence (souvent clive aprstranslocation)

    La protine (prcurseur) passe linairement Le passage seffectue au niveau dun pore

    aqueux

  • Description biochimique rapide:Mitochondrie

    H+ADP ATP

    H+ATP synthase

    Respiratorychain

    Presequence

  • Importation mitochondriale:description biochimique (2)

    Importation post-traductionnelle: synthsecytoplasmique sur polysomes

    Prsquence : En N-terminal Environ 20 rsidus, avec rsidus basiques et jamais acides

    La prsquence greffe en N-ter dune protinepassagre (DHFR) la dirige vers la mitochondrie

    Il existe des compartiments multiples : rle de laprsquence

  • Importation mitochondriale:description biochimique (3)

    PrcurseurProtineclive

    Mitochondries 0 + +

    Protinase K 0 0 +

    Limportation est signe par: i) la protection contre la protinase K; ii) laperte de la prsquence

    Limportation requiert: i) de lATP mitochondrial et cytosolique; ii) un

  • Importation dans le reticulum endoplasmique:description biochimique rapide

    Limportation est co-traductionnelleElle ncessite une prsquence en N-ter (squence leader), caractre essentiellement hydrophobeLa prsquence est gnralement clive aprs limportation

  • LA TRANSLOCATION A LIEU TRAVERS UN CANAL AQUEUX

    Mise en vidence sur le reticulumendoplasmique

  • La translocation a lieu travers un canalaqueux : cas du reticulum (1)

    Principe: mettre une sondefluorescente des endroitsdfinis pour sonderlenvironnement

    mARN de longueur dfiniepour avoir une protineconnue (1)

    tARN lysine modifi sur NH2par NBD pour avoir unmarqueur des positionsdfinies (2)

    Analyse par temps de vie defluorescence (3)

    Crawley et al, Cell(1994) 78, 461; Hamman

    et al, Cell (1997) 89, 535

  • la terminaison de lasynthse requiert descodons spcifiques

    en leur absence, lachane reste attache ausite P du ribosome

    llongation se fait parun tARN charg par unacide amin

    on peut modifier le NH2en position dun tARNcharg par le NBD

    Donnes biologiques

  • La translocation a lieu travers un canalaqueux : cas du reticulum (2)

    Rsultats: Ribosomes sans membrane:

    NBD dans leau Accessible KI (quencher)

    Ribosomes + Membrane NBD dans leau Accessible KI aprs permabilisation

    (SLO), seulement si > 70 rsidus Daprs la taille des quenchers, le

    canal aurait 40 de diamtre

  • La translocation a lieu travers un canalaqueux : cas du reticulum (3)

    Conclusions; La prsquence et la chane sont dans un

    environnement aqueux, inaccessible partir ducytoplasme

    Le ribosome et la membrane forment un canalcontinu

    Une longueur minimale est ncessaire pour mergerdu canal

  • Durant la translocation dans le reticulum, laprotine est dans une conformation allonge (1)

    On utilise le mme protocole:protine de longueur variablefixe au ribosome (pas determinaison)

    On ajoute un site de N-glycosylation et on cherche lalongueur minimale permettant laglycosylation

    Comme tmoin, on ajoute de lapuromycine: libration duribosome et glycosylation

    RM: membrane de reticulum

  • Durant la translocation dans le reticulum, laprotine est dans une conformation allonge (2)

    Rsultats: La glycosylation ncessite 65

    rsidus entre le ribosome (siteP) et lenzyme OST

    La microscopie lectroniqueindique que cette distance estde 200 (ribosome 150 +membrane 50)

    Soit 200 /65 = 3,1 /rsiduHlice : 1,5 /rsiduConformation tendue: 3,5

  • MISE EN VIDENCELECTROPHYSIOLOGIQUE DU PORE

    Cas du reticulum Cas de la mitochondrie

    Membrane externe : le PSC (Membrane interne : TIM23)

  • Mise en vidence lectrophysiologique dupore: cas du reticulum (1)

    On utilise lapproche bicouches planes: mesure du courant entre 2compartiments potentiel impos

    On fusionne des microsomes (vsicules de reticulum rugueux) avec labicouche prforme

    Simon and Blobel, Cell (1991) 65, 371

  • Mise en vidence lectrophysiologique dupore: cas du reticulum (2)

    A V = 0, aprs la fusion, aucun courant: le pore serait obstrupar les chanes en croissance bloques au site P

    La puromycine est une drogue qui force la terminaison: elleinduit le relargage des chanes et libre le pore.

  • Mise en vidence lectrophysiologique dupore: cas du reticulum (3)

    Conductances mesures aprs addition de 100 ou 0,3 M depuromycine

    A 0,3 M, on distingue des vnements quantiques, dunevaleur unitaire denviron 200 pS dans les conditions ioniquesutilises (canal de grande taille)

  • Mise en vidence lectrophysiologique dupore: cas du reticulum (4)

    Laddition de KCl 300mM de concentration finaledcroche les ribosomes dela membrane microsomiale

    On observe alors unefermeture du canal

  • LE SYSTME DIMPORTATION DE LAMEMBRANE EXTERNE DE LA

    MITOCHONDRIE (TOM)

    Le Peptide Sensitive Channel PSC

  • La mthode dobservation initiale

    Une autre mthode dobservation:le dip-tip

    Le bain contient des fragmentsmembranaires (vsicules) avecdes canaux; une monocouche seforme en surface

    Une pipette de patch-clamp estsortie du bain: formation dunemonocouche la pointe

    La pipette est rentre dans lebain : apposition desmonocouches

    Thieffry et al (1988) EMBO J ,7, 1449

  • Activit rapide

    Canal de grande taille;220 pS

    Structure dimrique

    Faible slectivitcationique

    Dpendance vis--visdu potentiel

    Le PSC de mitochondries de corticosurrnales

  • Dpendance (/potentiel) de la probabilitdobservation des 3 tats

    Etat 3 (dimre)

    Etat 2 (monomre)

    Etat 1 (ferm)

  • Caractristiques du PSC

    Le PSC est prsent sur toutes les mitochondriestestes

    Il peut prendre des formes diffrentes: chez la levure,il ny a pas les fermetures longues

    Il est prsent uniquement sur la membrane externedes mitochondries

    Il est observable par dautres techniques comme lesbicouches planes ou le patch-clamp de vsiculesgantes

  • Le PSC est inhib par des peptides basiquescomme les prsquences mitochondriales

    NOTRTGAECKQTMLTQRpRIHBYESNKGCIKRCIHPKIVHRKCNCKIReduced MCDYESYGGFLRRGFKVVTDynorphin B

    PEPTIDES

    YESMLSKLASLQTVAALRRGLRTSVASATSVATKKTE

    (1-34) p-Ornithineaminotransferase

    YESMLSLRQSIRFFKPATRTLCSSRpL4(1-22)YESMLSLRQSIRFFKPATRpL4(1-16)

    YESMLSLRQSIRFFKYpL4(1-12)YCyt c oxidase subunit4PRESEQUENCES

    PSCINHIBITION

    SEQUENCEPEPTIDES

  • Effet de prsquences sur le PSC de levure

    Le canal est observ parDip-tip, puis transfr dansun bain contenant le peptide

    (haut) Fermetures induitespar une prsquence de 16rsidus; leffet est maximal + 10 mV

    A - 50 mV, les fermeturessont plus nombreuses, maisleur dure est plus courte

    (bas) Dure des fermeturespour le peptide de 16 rsiduset pour un peptide de 13rsidus

  • Interprtation du blocage

    A V > 0, le peptide cationique estfaiblement attir dans le canal :blocages peu nombreux

    Quand V diminue, le nombre maisaussi la dure des blocage augmentent

    A V = 10 mV, lattraction est suffisantepour que le peptide franchisse le canal :la dure des blocages diminue

    A V < 0, le nombre des blocagescontinue augmenter et leur dure diminuer

    Les peptides dadressage passent travers le PSC

  • Les fermetures proviennent dinteractions avecdes peptides

    Le transfert dun PSC de levure maintenu - 30 mV dans un bain contenantune prsquence de 22 rsidus montre des fermetures rapides (passage dupeptide) et aprs lavage, des fermetures longues, mimant le PSC demammifre

    Lopration peut tre rpte : les portes ne sont pas covalentes

  • Schma dinterprtation des fermetures du PSC

    Trypsin

    Cytosol

    Intermembrane spacePSC

    Presequence Modle:

    le systme detranslocation comportedes sites de liaison surles 2 faces

    Chez les mammifres,on isole le PSC avec despeptides-signal lis

    Ces peptides donnentdes fermetures

  • Energtique et vectorialit du transportmitochondrial

    Pour une protine de la matrice, transport travers 2 membranes; lessystmes dimportation sont coupls de manire dynamique

    Des chaperons cytosoliques maintiennent la protine droule lextrieur Le potentiel facilite le passage de la prsquence Des chaperons mitochondriaux capturent la protine importe, biaisent le

    mouvement brownien et facilitent la renaturation

  • Principe du cliquet brownien

    La chane droule est soumise aumouvement brownien au cours deson passage travers le pore

    Ds leur translocation, lessquences sont prises en chargepar des chaperons ou des enzymes

    Ces liaisons ou modificationsempchent le retour de la chane etdonnent la directionalit

    Dans le reticulum, le ribosomepousse la chane synthtise et elleest prise en charge en trans

    Remarque: au niveau du reticulum, il existe aussi des protines transportespost-traductionnellement. Chez les bactries, le mode post-traductionnel estdominant

  • Biochimie simplifie des systmesdimportation mitochondriaux

    Les 2 systmes TOM et TIM ontt purifis et reconstitus enmembrane

    Les activits canal de TOM etTIM sont portes par,respectivement, TOM40 et TIM23

    TOM purifi et reconstitu alactivit PSC (Kunkele et al(1998) J Biol Chem 273, 31032)